PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 90aa    MW: 10328.8 Da    PI: 10.2395
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14466genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g+W++++r  g++R++k+c++rw++yl
         EMT14466 16 KGLWSPEEDEKLYNHIIRHGVGCWSSVPRLAGLHRCGKSCRLRWLNYL 63
                     678********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2091167IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-211462IPR009057Homeodomain-like
SMARTSM007176.8E-141565IPR001005SANT/Myb domain
PfamPF002495.1E-161663IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-211889IPR009057Homeodomain-like
CDDcd001678.93E-121963No hitNo description
Gene3DG3DSA:1.10.10.601.5E-76389IPR009057Homeodomain-like
PROSITE profilePS500904.0776490IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MERPSSGGLG QPKLRKGLWS PEEDEKLYNH IIRHGVGCWS SVPRLAGLHR CGKSCRLRWL  60
NYLRPNLRRG SFSQQEEDHI IALHQILGNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-141089179B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2521451e-113AB252145.1 Triticum aestivum Tamyb2 mRNA for myb-related protein, complete cds.
GenBankKM0669461e-113KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.17e-49PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-54MYB3_HORVU; Myb-related protein Hv33
TrEMBLN1QZ789e-61N1QZ78_AEGTA; Myb-related protein Hv33
STRINGSi022730m2e-48(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.17e-41myb domain protein 86